ERCC1 (NM_001983) Human Recombinant Protein

ERCC1 protein,

Product Info Summary

SKU: PROTP07992
Size: 20 µg
Source: HEK293T

Product Name

ERCC1 (NM_001983) Human Recombinant Protein

View all ERCC1 recombinant proteins

SKU/Catalog Number

PROTP07992

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ERCC1 (NM_001983) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP07992)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.562kDa

Amino Acid Sequence

MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ERCC1 (Source: Uniprot.org, NCBI)

Gene Name

ERCC1

Full Name

DNA excision repair protein ERCC-1

Weight

32.562kDa

Superfamily

ERCC1/RAD10/SWI10 family

Alternative Names

COFS4; DNA excision repair protein ERCC-1; ERCC1; excision repair cross-complementing rodent repair deficiency, complementationgroup 1 (includes overlapping antisense sequence); RAD10; UV20 ERCC1 COFS4, RAD10, UV20 ERCC excision repair 1, endonuclease non-catalytic subunit DNA excision repair protein ERCC-1|excision repair cross-complementation group 1|excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ERCC1, check out the ERCC1 Infographic

ERCC1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ERCC1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP07992

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ERCC1 (NM_001983) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ERCC1 (NM_001983) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ERCC1 (NM_001983) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP07992
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.